Transcript: ENSMUST00000087332.5 Gm16223-201

Description

predicted gene 16223 [Source:MGI Symbol;Acc:MGI:3648966]

Gene Synonyms

EG433882

Location

Chromosome 5: 42,225,303-42,374,141 forward strand.

About this transcript

This transcript has 3 exons, is associated with 7612 variant alleles and maps to 115 oligo probes.

Gene

This transcript is a product of gene ENSMUSG00000067285.6 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	Flags
ENSMUST00000340693.1	Gm16223-202	2903	No protein	-	lncRNA	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, GENCODE Primary represents a minimal set that contains MANE Select, MANE Plus Clinical and Ensembl Canonical transcripts and transcripts containing any conserved exons and common alternative splicing events (including exons skips) that are absent from the MANE and Ensembl Canonical transcripts for protein-coding genes. Other biotypes will have the GENCODE Primary flag added to the Ensembl Canonical transcript and for lncRNA genes only this will be the transcripts with the longest genomic span.GENCODE Primary, A subset of the GENCODE transcript set, containing only 5' and 3' complete transcripts at protein-coding genes.GENCODE Basic,
ENSMUST00000087332.5	Gm16223-201	2530	No protein	-	lncRNA	A subset of the GENCODE transcript set, containing only 5' and 3' complete transcripts at protein-coding genes.GENCODE Basic, TSL 1: A transcript where all splice junctions are supported by at least one non-suspect mRNA. The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users, based on the type and quality of the alignments used to annotate the transcript. TSL:1,
ENSMUST00000340694.1	Gm16223-203	1122	No protein	-	lncRNA	A subset of the GENCODE transcript set, containing only 5' and 3' complete transcripts at protein-coding genes.GENCODE Basic,
ENSMUST00000340698.1	Gm16223-207	1089	No protein	-	lncRNA	A subset of the GENCODE transcript set, containing only 5' and 3' complete transcripts at protein-coding genes.GENCODE Basic,
ENSMUST00000340696.1	Gm16223-205	890	No protein	-	lncRNA	-
ENSMUST00000340695.1	Gm16223-204	880	No protein	-	lncRNA	-
ENSMUST00000340697.1	Gm16223-206	649	No protein	-	lncRNA	-

ID History

Stable ID

ENSMUST00000087332.5

Status

Current

Latest Version

ENSMUST00000087332.5

Release: 116 (current)

Assembly: GRCm39

Database: mus_musculus_core_116_39

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
108	ENSMUSG00000067285	ENSMUST00000087332.5	ENSMUSP00000084590 `CSALSSFPQRFWRQTLPSGDLQVWSCSPRGFGGERTGLTGEGGQETGVRTCLLTEDEGLK QGLSQNLCSFCSPHSHLCRLVSAESGNQDGSPRCCGKAFLGGADTYPLAACCFHLMV`

Upcoming Ensembl Platform Transition

Transcript: ENSMUST00000087332.5 Gm16223-201

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Upcoming Ensembl Platform Transition

Favourite species

All species

Recent locations

Transcript: ENSMUST00000087332.5 Gm16223-201

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us