Transcript: ENSDART00000162795.2 CCND1-202

Description

cyclin D1 [Source:ZFIN;Acc:ZDB-GENE-980526-176]

Location

Chromosome 7: 54,672,940-54,677,379 reverse strand.

About this transcript

This transcript has 3 exons, is associated with 198 variant alleles and maps to 105 oligo probes.

Gene

This transcript is a product of gene ENSDARG00000101637.2 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	UniProt Match	Flags
ENSDART00000163748.2	CCND1-205	5658	291aa	ENSDARP00000140550.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A7YYE4 Q90459	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, APPRIS P1: Transcript(s) expected to code for the main functional isoform based solely on the core modules in the APPRIS. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P1,
ENSDART00000165320.2	CCND1-203	2742	291aa	ENSDARP00000134435.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A7YYE4 Q90459	APPRIS P1: Transcript(s) expected to code for the main functional isoform based solely on the core modules in the APPRIS. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P1,
ENSDART00000170774.2	CCND1-204	840	210aa	ENSDARP00000133850.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	-
ENSDART00000162795.2	CCND1-202	881	76aa	ENSDARP00000129985.1	Nonsense mediated decay	-	-
ENSDART00000171395.2	CCND1-201	673	No protein	-	An alternatively spliced transcript believed to contain intronic sequence relative to other, coding, transcripts of the same gene.Retained intron	-	-

ID History

Stable ID

ENSDARP00000129985.1

Status

Current

Latest Version

ENSDARP00000129985.1

Release: 114 (current)

Assembly: GRCz11

Database: danio_rerio_core_114_11

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
91	ENSDARG00000101637	ENSDART00000162795.1	ENSDARP00000129985 `MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV ATWMLETSTSSQALPP`

Transcript: ENSDART00000162795.2 CCND1-202

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: ENSDART00000162795.2 CCND1-202

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us