Transcript: ENSDART00000138696.2 G6PD-202

Description

glucose-6-phosphate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-070508-4]

Location

Chromosome 23: 13,844,920-13,877,898 reverse strand.

About this transcript

This transcript has 14 exons, is annotated with 19 domains and features, is associated with 872 variant alleles and maps to 263 oligo probes.

Gene

This transcript is a product of gene ENSDARG00000071065.7 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	UniProt Match	Flags
ENSDART00000138696.2	G6PD-202	4080	523aa	ENSDARP00000115363.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	F6NHI0	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, APPRIS ALT1: For genes in which the APPRIS core modules are unable to choose a clear principal isoform, the ALT1 is the candidate transcript(s) models that is conserved in at least three tested species. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS ALT1,
ENSDART00000193807.1	G6PD-205	6829	513aa	ENSDARP00000151797.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	E7FDY7	APPRIS P4: Where the APPRIS core modules are unable to choose a clear principal CDS and there is more than one variant with a distinct (but consecutive) CCDS identifiers, APPRIS selects the longest CCDS isoform as the principal variant. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P4,
ENSDART00000104834.6	G6PD-204	6663	513aa	ENSDARP00000095604.4	Gene/transcipt that contains an open reading frame (ORF).Protein coding	E7FDY7	APPRIS P4: Where the APPRIS core modules are unable to choose a clear principal CDS and there is more than one variant with a distinct (but consecutive) CCDS identifiers, APPRIS selects the longest CCDS isoform as the principal variant. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P4,
ENSDART00000139406.2	G6PD-201	334	No protein	-	Gene/transcript that doesn't contain an open reading frame (ORF).Processed transcript	-	-
ENSDART00000145928.2	G6PD-203	267	No protein	-	Gene/transcript that doesn't contain an open reading frame (ORF).Processed transcript	-	-

ID History

Stable ID

ENSDARP00000115363.1

Status

Current

Latest Version

ENSDARP00000115363.1

Release: 114 (current)

Assembly: GRCz11

Database: danio_rerio_core_114_11

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
91	ENSDARG00000071065	ENSDART00000138696.1	ENSDARP00000115363 MMGSRASADKMSLPLSRSEVFGQLRKELHDDTAFHQSDVHIFIIMGASGDLAKKKIYPTL WWLFRDGLLPEQTYFVGFARSDLTVDAIRIACMPYMKVVDNEAERLAAFFSRNSYISGKY VEESSFSDLNTHLLSLPGGAEANRLFYLALPPSVYHDVTKNIKHQCMSTKGWNRVIVEKP FGRDLQSSEELSSHLSSLFTEEQIYRIDHYLGKEMVQNLMVLRFGNRIFGPIWNRDSVAC VVLTFKEPFGTQGRGGYFDDFGIIRDVMQNHLLQMLSLVAMEKPASTSSDDVRDEKVKVL KCIEPVTLSDVVLGQYVGDPDGEGEAKLGYLDDKTVPKGSTQATFATAVLYVKNERWDGV PFILRCGKALNERKAEVRLQFTDVPGDIFSSQCRRNELVVRVQPNEAIYAKMMSKKPGVY FSPEETELDLTYHSRYRDVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQI ESEKTPPIKYKYGSRGPAEADELVQKVGFRYEGTYKWVNPHKL

Transcript: ENSDART00000138696.2 G6PD-202

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: ENSDART00000138696.2 G6PD-202

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us