Transcript: ENSDART00000148306.3 map2-207

Description

microtubule-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-041010-118]

Location

Chromosome 9: 38,888,025-38,967,999 forward strand.

About this transcript

This transcript has 6 exons, is annotated with 6 domains and features, is associated with 1367 variant alleles and maps to 195 oligo probes.

Gene

This transcript is a product of gene ENSDARG00000055052.8 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	Flags
ENSDART00000135902.3	map2-204	1437	248aa	ENSDARP00000112889.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical,
ENSDART00000140436.3	map2-205	3808	591aa	ENSDARP00000119478.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	5' truncation in transcript evidence prevents annotation of the start of the CDS.CDS 5' incomplete,
ENSDART00000134294.3	map2-202	1122	374aa	ENSDARP00000114436.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	5' and 3' truncations in transcript evidence prevent annotation of the start and the end of the CDS.CDS 5' and 3' incomplete,
ENSDART00000112298.4	map2-201	879	292aa	ENSDARP00000104237.4	Gene/transcipt that contains an open reading frame (ORF).Protein coding	APPRIS P1: Transcript(s) expected to code for the main functional isoform based solely on the core modules in the APPRIS. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P1,
ENSDART00000144893.2	map2-206	829	154aa	ENSDARP00000117711.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	5' truncation in transcript evidence prevents annotation of the start of the CDS.CDS 5' incomplete,
ENSDART00000148306.3	map2-207	646	179aa	ENSDARP00000121959.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	3' truncation in transcript evidence prevents annotation of the end of the CDS.CDS 3' incomplete,
ENSDART00000135581.2	map2-203	505	169aa	ENSDARP00000117371.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	5' and 3' truncations in transcript evidence prevent annotation of the start and the end of the CDS.CDS 5' and 3' incomplete,

ID History

Stable ID

ENSDARP00000121959.1

Status

Current

Latest Version

ENSDARP00000121959.1

Release: 114 (current)

Assembly: GRCz11

Database: danio_rerio_core_114_11

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
79	ENSDARG00000055052	ENSDART00000148306.1	ENSDARP00000121959 `MADGRQPEDSGPQWSSPGAQGSSSPGGHGENGFSSSYRTCQPGAGSATYAKENGFNGDLT SGHAVTAEQVSARIVQEVTAEAVAVLKGEQELHPETAVRLPSVEDSANLPPSPPPSPAAE HFGPLDQVSADGRLPFSVARHSRDRASTSNPTTLTKIPTSKIRAEALLPARPNSASSSN`
91	ENSDARG00000055052	ENSDART00000148306.2	ENSDARP00000121959 `MADGRQPEDSGPQWSSPGAQGSSSPGGHGENGFSSSYRTCQPGAGSATYAKENGFNGDLT SGHAVTAEQVSARIVQEVTAEAVAVLKGEQELHPETAVRLPSVEDSANLPPSPPPSPAAE HFGPLDQVSADGRLPFSVARHSRDRASTSNPTTLTKIPTSKIRAEALLPARPNSASSSN`

Transcript: ENSDART00000148306.3 map2-207

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: ENSDART00000148306.3 map2-207

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us