Transcript: ENSDART00000126655.4 THOC2-205

Description

THO complex 2 [Source:ZFIN;Acc:ZDB-GENE-030616-54]

Location

Chromosome 14: 12,391,920-12,410,999 forward strand.

About this transcript

This transcript has 7 exons, is annotated with 2 domains and features, is associated with 212 variant alleles and maps to 67 oligo probes.

Gene

This transcript is a product of gene ENSDARG00000037503.8 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	UniProt Match	Flags
ENSDART00000106626.5	THOC2-203	5492	1560aa	ENSDARP00000097404.3	Gene/transcipt that contains an open reading frame (ORF).Protein coding	F1QXF4	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, APPRIS P1: Transcript(s) expected to code for the main functional isoform based solely on the core modules in the APPRIS. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P1,
ENSDART00000054611.6	THOC2-206	5471	1504aa	ENSDARP00000054610.4	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	-
ENSDART00000115408.5	THOC2-207	5457	1535aa	ENSDARP00000099604.5	Gene/transcipt that contains an open reading frame (ORF).Protein coding	F1R5B5	-
ENSDART00000126655.4	THOC2-205	1063	154aa	ENSDARP00000141871.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	-
ENSDART00000143316.3	THOC2-202	2584	No protein	-	An alternatively spliced transcript believed to contain intronic sequence relative to other, coding, transcripts of the same gene.Retained intron	-	-
ENSDART00000146178.2	THOC2-201	574	No protein	-	An alternatively spliced transcript believed to contain intronic sequence relative to other, coding, transcripts of the same gene.Retained intron	-	-
ENSDART00000141138.2	THOC2-204	352	No protein	-	An alternatively spliced transcript believed to contain intronic sequence relative to other, coding, transcripts of the same gene.Retained intron	-	-

ID History

Stable ID

ENSDARP00000141871.1

Status

Current

Latest Version

ENSDARP00000141871.1

Release: 114 (current)

Assembly: GRCz11

Database: danio_rerio_core_114_11

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
91	ENSDARG00000037503	ENSDART00000126655.3	ENSDARP00000141871 `MAALILPFDWLKNWDKSGRNEFLQFFQDLAGKSSGHELVKDLQTAFYELCWHAIQGSLKV DVAASLLADVMELRDDMPSILADVLCILDIETGCLEEKHKRDLFTQLVGACLICIPDGVL KERLDPETLESLGLIKQAQQFNQKIVKIKTKLLL`

Transcript: ENSDART00000126655.4 THOC2-205

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: ENSDART00000126655.4 THOC2-205

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us