Transcript: ENSDART00000174216.2 CDKN2AIP-201

Description

CDKN2A interacting protein [Source:ZFIN;Acc:ZDB-GENE-041010-188]

Location

Chromosome 7: 52,949,847-52,957,888 forward strand.

About this transcript

This transcript has 4 exons, is annotated with 1 domain and feature, is associated with 22 variant alleles and maps to 119 oligo probes.

Gene

This transcript is a product of gene ENSDARG00000035853.7 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	UniProt Match	Flags
ENSDART00000052030.7	CDKN2AIP-203	3180	312aa	ENSDARP00000052029.4	Gene/transcipt that contains an open reading frame (ORF).Protein coding	F1QZX8	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, APPRIS P1: Transcript(s) expected to code for the main functional isoform based solely on the core modules in the APPRIS. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P1,
ENSDART00000187559.1	CDKN2AIP-205	3750	312aa	ENSDARP00000151655.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	F1QZX8	APPRIS P1: Transcript(s) expected to code for the main functional isoform based solely on the core modules in the APPRIS. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P1,
ENSDART00000174240.2	CDKN2AIP-204	916	259aa	ENSDARP00000143174.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	3' truncation in transcript evidence prevents annotation of the end of the CDS.CDS 3' incomplete,
ENSDART00000174055.2	CDKN2AIP-202	805	30aa	ENSDARP00000143040.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	-
ENSDART00000174216.2	CDKN2AIP-201	798	30aa	ENSDARP00000143003.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	-

ID History

Stable ID

ENSDARP00000143003.1

Status

Current

Latest Version

ENSDARP00000143003.1

Release: 114 (current)

Assembly: GRCz11

Database: danio_rerio_core_114_11

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
91	ENSDARG00000035853	ENSDART00000174216.1	ENSDARP00000143003 `MAARRGEDIVSEFLSQNPHLISAACDGQDK`

Transcript: ENSDART00000174216.2 CDKN2AIP-201

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: ENSDART00000174216.2 CDKN2AIP-201

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us