Transcript: ENSDART00000046035.7 MAX-207

Description

myc associated factor X [Source:ZFIN;Acc:ZDB-GENE-990415-152]

Location

Chromosome 20: 28,832,762-28,842,524 reverse strand.

About this transcript

This transcript has 4 exons, is annotated with 17 domains and features, is associated with 195 variant alleles and maps to 508 oligo probes.

Gene

This transcript is a product of gene ENSDARG00000024844.11 Show transcript tableHide transcript table

Transcript ID	Name	bp	Protein	Translation ID	Biotype	UniProt Match	Flags
ENSDART00000129858.4	MAX-206	996	160aa	ENSDARP00000111552.2	Gene/transcipt that contains an open reading frame (ORF).Protein coding	Q6NY29	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, APPRIS P4: Where the APPRIS core modules are unable to choose a clear principal CDS and there is more than one variant with a distinct (but consecutive) CCDS identifiers, APPRIS selects the longest CCDS isoform as the principal variant. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS P4,
ENSDART00000046035.7	MAX-207	1765	156aa	ENSDARP00000046034.5	Gene/transcipt that contains an open reading frame (ORF).Protein coding	Q803J7	-
ENSDART00000135720.3	MAX-205	1194	156aa	ENSDARP00000114266.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	Q803J7	-
ENSDART00000137425.3	MAX-201	911	151aa	ENSDARP00000119638.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	Q5SPG2	APPRIS ALT1: For genes in which the APPRIS core modules are unable to choose a clear principal isoform, the ALT1 is the candidate transcript(s) models that is conserved in at least three tested species. APPRIS is a system to annotate alternatively spliced transcripts based on a range of computational methods to identify the most functionally important transcript(s) of a gene. APPRIS ALT1,
ENSDART00000139843.2	MAX-202	568	129aa	ENSDARP00000115643.1	Gene/transcipt that contains an open reading frame (ORF).Protein coding	-	-
ENSDART00000132119.2	MAX-204	3204	No protein	-	Gene/transcript that doesn't contain an open reading frame (ORF).Processed transcript	-	-
ENSDART00000153271.2	MAX-203	563	No protein	-	An alternatively spliced transcript believed to contain intronic sequence relative to other, coding, transcripts of the same gene.Retained intron	-	-

ID History

Stable ID

ENSDARP00000046034.5

Status

Current

Latest Version

ENSDARP00000046034.5

Release: 114 (current)

Assembly: GRCz11

Database: danio_rerio_core_114_11

Associated archived IDs for this stable ID version

Release	Gene	Transcript	Protein
79	ENSDARG00000024844	ENSDART00000046035.5	ENSDARP00000046034 `MSDNDDIEVDSDADKRAHHNALERKRRDHIKDSFHSLRDSVPALQGEKQSIKQASRAQIL DKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKVKGTTQLQANYSSSDSSLYT NPKGSAVSAFDGGSDSSSESEPEEQRTRKKHRPEDS`
91	ENSDARG00000024844	ENSDART00000046035.6	ENSDARP00000046034 `MSDNDDIEVDSDADKRAHHNALERKRRDHIKDSFHSLRDSVPALQGEKQSIKQASRAQIL DKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKVKGTTQLQANYSSSDSSLYT NPKGSAVSAFDGGSDSSSESEPEEQRTRKKHRPEDS`

Transcript: ENSDART00000046035.7 MAX-207

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: ENSDART00000046035.7 MAX-207

ID History

Associated archived IDs for this stable ID version

About Us

Get help

Our sister sites

Follow us