Description

gulonolactone (L-) oxidase [Source:RGD Symbol;Acc:620701]

Location
About this transcript

This transcript has 12 exons, is annotated with 15 domains and features and maps to 24 oligo probes.

NameTranscript IDbpProteinTranslation IDBiotypeRefSeqFlags
Gulo-201ENSRNOT000000227022299440aaENSRNOP00000022703
 
Protein coding
NM_022220
NP_071556
APPRIS P1
Stable ID

ENSRNOP00000022703.4

Status

Current

Latest Version

ENSRNOP00000022703.4

Release: 81 (current)

Assembly: Rnor_6.0

Database: rattus_norvegicus_core_81_6

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
79ENSRNOG00000016648ENSRNOT00000022702ENSRNOP00000022703
MVHGYKGVQFQNWAKTYGCSPEVYYQPTSVEEVREVLALAREQKKKVKVVGGGHSPSDIA
CTDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLADLHPQLDEHGLAMSNLGAVSDVTVAG
VIGSGTHNTGIKHGILATQVVALTLMTADGEVLECSESRNADVFQAARVHLGCLGIILTV
TLQCVPQFHLQETSFPSTLKEVLDNLDSHLKRSEYFRFLWFPHTENVSIIYQDHTNKAPS
SASNWFWDYAIGFYLLEFLLWTSTYLPCLVGWINRFFFWMLFNCKKESSNLSHKIFTYEC
RFKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSC
YMNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTRKDFEEMYPTFHKFCDI
REKLDPTGMFLNSYLEKVFY

Transcript-based displays