Description

transmembrane and coiled-coil domains 4 [Source:MGI Symbol;Acc:MGI:1924306]

About this transcript

This transcript has 17 exons, is annotated with 10 domains and features, is associated with 31 variations and maps to 36 oligo probes.

NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
Tmco4-002ENSMUST000000509493318631aaENSMUSP00000059320
 
Protein coding
CCDS18837Q91WU4 NM_029857
NP_001292352
NP_084133
TSL:1GENCODE basicAPPRIS P1
Tmco4-001ENSMUST000000430422922631aaENSMUSP00000041388
 
Protein coding
CCDS18837Q91WU4 NP_001292352
TSL:1GENCODE basicAPPRIS P1
Tmco4-004ENSMUST0000012363666056aaENSMUSP00000122817
 
Protein coding
-A2ALL4 -CDS 3' incompleteTSL:3
Tmco4-003ENSMUST000001248351992No protein-
 
Processed transcript
---TSL:5
Stable ID

ENSMUSP00000059320.2

Status

Current

Latest Version

ENSMUSP00000059320.2

Release: 81 (current)

Assembly: GRCm38

Database: mus_musculus_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSMUSG00000041143ENSMUST00000050949ENSMUSP00000059320
MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGFSLSQLFPEPEQSSFC
TEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDPILRDNPSAVSQDLLSF
SLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDAKEEESETAEASRKRKEK
RRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSVAGIAVMTSL
FGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAITGWLGSGRYRTFNAPWMALA
RSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVA
NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDC
QGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQ
PVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGIRTKPGWREKGLPLAPGSLPQEEP
LQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSASQAQMPAGLNQSTEDSLSTAAAPAE
GHLICSHGVGPNPLGCPDCTHGTQESCTELD
77ENSMUSG00000041143ENSMUST00000050949ENSMUSP00000059320
MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGFSLSQLFPEPEQSSFC
TEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDPILRDNPSAVSQDLLSF
SLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDAKEEESETAEASRKRKEK
RRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSVAGIAVMTSL
FGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAITGWLGSGRYRTFNAPWMALA
RSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVA
NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDC
QGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQ
PVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGIRTKPGWREKGLPLAPGSLPQEEP
LQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSASQAQMPAGLNQSTEDSLSTAAAPAE
GHLICSHGVGPNPLGCPDCTHGTQESCTELD
79ENSMUSG00000041143ENSMUST00000050949ENSMUSP00000059320
MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGFSLSQLFPEPEQSSFC
TEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDPILRDNPSAVSQDLLSF
SLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDAKEEESETAEASRKRKEK
RRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSVAGIAVMTSL
FGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAITGWLGSGRYRTFNAPWMALA
RSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVA
NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDC
QGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQ
PVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGIRTKPGWREKGLPLAPGSLPQEEP
LQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSASQAQMPAGLNQSTEDSLSTAAAPAE
GHLICSHGVGPNPLGCPDCTHGTQESCTELD
80ENSMUSG00000041143ENSMUST00000050949ENSMUSP00000059320
MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGFSLSQLFPEPEQSSFC
TEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDPILRDNPSAVSQDLLSF
SLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDAKEEESETAEASRKRKEK
RRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSVAGIAVMTSL
FGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAITGWLGSGRYRTFNAPWMALA
RSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVA
NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDC
QGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQ
PVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGIRTKPGWREKGLPLAPGSLPQEEP
LQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSASQAQMPAGLNQSTEDSLSTAAAPAE
GHLICSHGVGPNPLGCPDCTHGTQESCTELD

Transcript-based displays