Description

inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma [Source:HGNC Symbol;Acc:HGNC:5961]

Synonyms

FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9

About this transcript

This transcript has 4 exons, is annotated with 4 domains and features, is associated with 46 variations and maps to 17 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
IKBKG-004ENST000005942392299419aaENSP00000471166
 
Protein coding
CCDS14757Q9Y6K9 NM_001099857
NP_001093327
TSL:1GENCODE basicAPPRIS P2
IKBKG-005ENST000006110712103419aaENSP00000479662
 
Protein coding
CCDS14757Q9Y6K9 NM_003639
NP_003630
TSL:1GENCODE basicAPPRIS P2
IKBKG-002ENST000006186702069487aaENSP00000483825
 
Protein coding
CCDS48196Q9Y6K9 NM_001099856
NP_001093326
TSL:1GENCODE basic
IKBKG-006ENST000006111761654320aaENSP00000478616
 
Protein coding
CCDS48197Q9Y6K9 NM_001145255
NP_001138727
TSL:2GENCODE basic
IKBKG-017ENST000006172071949418aaENSP00000484023
 
Protein coding
-A0A087X1B1 -TSL:3GENCODE basicAPPRIS ALT1
IKBKG-014ENST000006199411463412aaENSP00000478979
 
Protein coding
-A0A087WUW6 -TSL:5GENCODE basicAPPRIS ALT2
IKBKG-016ENST000006158741460411aaENSP00000483381
 
Protein coding
-A0A087X0G7 -TSL:5GENCODE basic
IKBKG-007ENST00000440286960251aaENSP00000394934
 
Protein coding
-C9JN51 -CDS 3' incompleteTSL:5
IKBKG-009ENST00000413620892195aaENSP00000398579
 
Protein coding
-C9J2V2 -CDS 3' incompleteTSL:5
IKBKG-008ENST00000422680841173aaENSP00000390368
 
Protein coding
-C9JH59 -CDS 3' incompleteTSL:2
IKBKG-012ENST00000445622693138aaENSP00000395205
 
Protein coding
-C9JCG6 -CDS 3' incompleteTSL:5
IKBKG-010ENST00000492469552181aaENSP00000484275
 
Protein coding
-A0A087X1K7 -CDS 5' incompleteTSL:5
IKBKG-013ENST00000615186488115aaENSP00000479144
 
Protein coding
-A0A087WV30 -CDS 3' incompleteTSL:5
IKBKG-003ENST00000612051197248aaENSP00000480431
 
Nonsense mediated decay
-A0A087WWQ9 -TSL:1
IKBKG-015ENST00000617838285No protein-
 
Processed transcript
---TSL:1
Stable ID

ENSP00000395205.1

Status

Current

Latest Version

ENSP00000395205.1

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000073009ENST00000445622ENSP00000395205
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAED
76ENSG00000269335ENST00000445622ENSP00000395205
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAED
78ENSG00000269335ENST00000445622ENSP00000395205
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAED
80ENSG00000269335ENST00000445622ENSP00000395205
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAED

Transcript-based displays