Description

insulin [Source:HGNC Symbol;Acc:6081]

Location
Gene

This transcript is a product of gene ENSG00000254647

This gene has 5 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLength (bp)Protein IDLength (aa)BiotypeCDS incompleteCCDSGENCODE basic
INS-003ENST00000397262639ENSP00000380432110Protein codingGenes and/or transcript that contains an open reading frame (ORF).-CCDS7729YThe GENCODE Basic set includes all genes in the GENCODE gene set but only a subset of the transcripts.
INS-001ENST00000381330597ENSP00000370731110Protein codingGenes and/or transcript that contains an open reading frame (ORF).-CCDS7729YThe GENCODE Basic set includes all genes in the GENCODE gene set but only a subset of the transcripts.
INS-002ENST00000250971503ENSP00000250971110Protein codingGenes and/or transcript that contains an open reading frame (ORF).-CCDS7729YThe GENCODE Basic set includes all genes in the GENCODE gene set but only a subset of the transcripts.
INS-005ENST00000421783464ENSP0000040840092Protein codingGenes and/or transcript that contains an open reading frame (ORF).3'--
INS-006ENST00000512523297ENSP0000042400898Protein codingGenes and/or transcript that contains an open reading frame (ORF).--YThe GENCODE Basic set includes all genes in the GENCODE gene set but only a subset of the transcripts.
Stable ID

ENSP00000424008.1

Status

Current

Latest Version

ENSP00000424008.1

Release: 75 (current)

Assembly: GRCh37

Database: homo_sapiens_core_75_37

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
60ENSG00000129965ENST00000512523ENSP00000424008
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Transcript-based displays