Description

insulin [Source:HGNC Symbol;Acc:HGNC:6081]

Synonyms

IDDM1, IDDM2

Location
Gene

This transcript is a product of gene ENSG00000254647

This gene has 5 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLengthProteinBiotypeCCDSUniProtRefSeqFlags
INS-003ENST00000397262639 bp110 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS7729F6MZK5 I3WAC9 P01308
NM_001185098
NP_001172027
NP_001278826
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
INS-001ENST00000381330597 bp110 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS7729F6MZK5 I3WAC9 P01308
NP_001278826
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
INS-002ENST00000250971503 bp110 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS7729F6MZK5 I3WAC9 P01308
NM_000207
NM_001185097
NP_000198
NP_001172026
NP_001278826
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
INS-005ENST00000421783464 bp92 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-C9JNR5 -CDS 3' incomplete3' truncation in transcript evidence prevents annotation of the end of the CDS.
INS-006ENST00000512523297 bp98 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-A6XGL2 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
Stable ID

ENSP00000370731.4

Status

Current

Latest Version

ENSP00000370731.4

Release: 76 (current)

Assembly: GRCh38

Database: homo_sapiens_core_76_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
60ENSG00000129965ENST00000381330ENSP00000370731
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Transcript-based displays