Description

major histocompatibility complex, class II, DQ alpha 2 [Source:HGNC Symbol;Acc:HGNC:4943]

Synonyms

HLA-DXA

About this transcript

This transcript has 5 exons, is annotated with 15 domains and features and is associated with 91 variations.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
HLA-DQA2-001ENST000004477351500255aaENSP00000393431
 
Protein coding
-P01906 NM_020056
NP_064440
TSL:NAGENCODE basic
HLA-DQA2-202ENST00000551533768255aaENSP00000448003
 
Protein coding
-P01906 -TSL:NAGENCODE basic
Stable ID

ENSP00000393431.1

Status

Current

Latest Version

ENSP00000393431.1

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000223793ENST00000447735ENSP00000393431
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
76ENSG00000223793ENST00000447735ENSP00000393431
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
78ENSG00000223793ENST00000447735ENSP00000393431
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL
80ENSG00000223793ENST00000447735ENSP00000393431
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL

Transcript-based displays