Description

carnitine palmitoyltransferase 1B (muscle) [Source:HGNC Symbol;Acc:HGNC:2329]

Synonyms

CPT1-M, M-CPT1

Location
Gene

This transcript is a product of gene ENSG00000205560

This gene has 13 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLengthProteinBiotypeCCDSUniProtRefSeqFlags
CPT1B-001ENST000003956502662 bp772 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS14098C9J7C3 K7N7A7 Q92523
NM_004377
NP_004368
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
CPT1B-005ENST000004052372647 bp772 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS14098C9J7C3 K7N7A7 Q92523
NM_001145135
NM_001145136
NM_001145137
NM_152245
NP_001138607
NP_001138608
NP_001138609
NP_689451
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
CPT1B-004ENST000003121082592 bp772 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS14098C9J7C3 K7N7A7 Q92523
NM_152246
NP_689452
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
CPT1B-201ENST000003607192319 bp772 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS14098C9J7C3 K7N7A7 Q92523
-GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
CPT1B-202ENST000004572502217 bp738 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS46734C9J7C3 K7N7A7 Q92523
NM_001145134
NP_001138606
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
CPT1B-008ENST00000417176558 bp125 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-C9J7C3 -CDS 3' incomplete3' truncation in transcript evidence prevents annotation of the end of the CDS.
CPT1B-020ENST00000423069719 bp92 aa (view)
 
Nonsense mediated decayTranscript is thought to undergo nonsense mediated decay, a process which detects nonsense mutations and prevents the expression of truncated or erroneous proteins.
-H7C0S1 -CDS 5' incomplete5' truncation in transcript evidence prevents annotation of the start of the CDS.
CPT1B-014ENST00000497224806 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
CPT1B-007ENST00000460853757 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
CPT1B-013ENST00000475238572 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
CPT1B-010ENST00000476790563 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
CPT1B-009ENST00000461117562 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
CPT1B-011ENST00000479886545 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
Stable ID

ENSP00000385486.3

Status

Current

Latest Version

ENSP00000385486.3

Release: 76 (current)

Assembly: GRCh38

Database: homo_sapiens_core_76_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000205560ENST00000405237ENSP00000385486
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS

Transcript-based displays