Description

POU class 5 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9221]

Synonyms

OTF3, Oct-3, MGC22487, Oct4, OTF4, OTF-3, OCT3, OCT4, Oct-4

Location
About this transcript

This transcript has 4 exons, is annotated with 11 domains and features, is associated with 65 variations and maps to 72 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
POU5F1-005ENST000005134072276164aaENSP00000475512
 
Protein coding
CCDS75420F2Z381 NM_001285986
NP_001272915
TSL:1GENCODE basic
POU5F1-002ENST000004715291723164aaENSP00000425083
 
Protein coding
CCDS75420F2Z381 -TSL:1GENCODE basic
POU5F1-202ENST000006200311578190aaENSP00000484778
 
Protein coding
CCDS47398U3KQH6 NM_001173531
NM_001285987
NM_203289
NP_001167002
NP_001272916
NP_976034
TSL:1GENCODE basic
POU5F1-001ENST000002599151420360aaENSP00000259915
 
Protein coding
CCDS34391D2IYK3 Q01860 NM_002701
NP_002692
TSL:1GENCODE basicAPPRIS P1
POU5F1-007ENST000006065671236190aaENSP00000475880
 
Protein coding
CCDS47398U3KQH6 -TSL:1GENCODE basic
POU5F1-006ENST000005128181233164aaENSP00000425479
 
Protein coding
CCDS75420F2Z381 -TSL:1GENCODE basic
POU5F1-004ENST000004418881055164aaENSP00000389359
 
Protein coding
CCDS75420F2Z381 -TSL:1GENCODE basic
POU5F1-201ENST000006193401084186aaENSP00000481679
 
Protein coding
-A0A087WYB7 -TSL:5GENCODE basic
POU5F1-003ENST00000461401791No protein-
 
Retained intron
---TSL:1
Stable ID

ENSP00000425083.1

Status

Current

Latest Version

ENSP00000425083.1

Release: 83 (current)

Assembly: GRCh38

Database: homo_sapiens_core_83_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000204531ENST00000471529ENSP00000425083
MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPT
LQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAP
GPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
76ENSG00000204531ENST00000471529ENSP00000425083
MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPT
LQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAP
GPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
78ENSG00000204531ENST00000471529ENSP00000425083
MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPT
LQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAP
GPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
80ENSG00000204531ENST00000471529ENSP00000425083
MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPT
LQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAP
GPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Transcript-based displays