Description

synaptic Ras GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:11497]

Synonyms

KIAA1938, RASA5, SYNGAP

Location
About this transcript

This transcript has 18 exons, is annotated with 29 domains and features, is associated with 422 variations and maps to 38 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
SYNGAP1-001ENST0000062938098621343aaENSP00000486463
 
Protein coding
CCDS34434-NM_006772
NP_006763
TSL:2GENCODE basicAPPRIS P2
SYNGAP1-010ENST0000041860058281285aaENSP00000403636
 
Protein coding
-Q96PV0 -TSL:5GENCODE basic
SYNGAP1-003ENST0000042898243391284aaENSP00000412475
 
Protein coding
-Q96PV0 -TSL:5GENCODE basic
SYNGAP1-007ENST0000062864642641299aaENSP00000486431
 
Protein coding
---TSL:5GENCODE basicAPPRIS ALT2
SYNGAP1-009ENST0000044937239301307aaENSP00000416519
 
Protein coding
-B7ZCA0 -CDS 3' incompleteTSL:5
SYNGAP1-004ENST0000029374845561284aaENSP00000293748
 
Nonsense mediated decay
-A0A0A0MQZ2 -CDS 5' incompleteTSL:5
SYNGAP1-005ENST00000495633260No protein-
 
Processed transcript
---TSL:5
SYNGAP1-002ENST000004795102073No protein-
 
Retained intron
---TSL:2
SYNGAP1-008ENST00000470232394No protein-
 
Retained intron
---TSL:3
Stable ID

ENSP00000416519.3

Status

Current

Latest Version

ENSP00000416519.3

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
80ENSG00000197283ENST00000449372ENSP00000416519
MSRSRASIHRGSIPAMSYAPFRDVRGPSMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLD
EDEIHPLLIRDRRSESSRNKLLRRTVSVPVEGRPHGEHEYHLGRSRRKSVPGGKQYSMEG
APAAPFRPSQGFLSRRLKSSIKRTKSQPKLDRTSSFRQILPRFRSADHDRARLMQSFKES
HSHESLLSPSSAAEALELNLDEDSIIKPVHSSILGQEFCFEVTTSSGTKCFACRSAAERD
KWIENLQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRS
ASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTE
QWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQTMSILPMELYKEF
AEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMERE
HLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAEHQ
ANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCP
AIMSPSLFGLMQEYPDEQTSRTLTLIAKVIQNLANFSKFTSKEDFLGFMNEFLELEWGSM
QQFLYEISNLDTLTNSSSFEGYIDLGRELSTLHALLWEVLPQLSKEALLKLGPLPRLLND
ISTALRNPNIQRQPSRQSERPRPQPVVLRGPSAEMQGYMMRDLNSSMDMARLPSPTKEKP
PPPPPGGGKDLFYVSRPPLARSSPAYCTSSSDITEPEQKMLSVNKSVSMLDLQGDGPGGR
LNSSSVSNLAAVGDLLHSSQASLTAALGLRPAPAGRLSQGSGSSITAAGMRLSQMGVTTD
GVPAQQLRIPLSFQNPLFHMAADGPGPPGGHGGGGGHGPPSSHHHHHHHHHHRGGEPPGD
TFAPFHGYSKSEDLSSGVPKPPAASILHSHSYSDEFGPSGTDFTRRQLSLQDNLQHMLSP
PQITIGPQRPAPSGPGGGSGGGSGGGGGGQPPPLQRGKSQQLTVSAAQKPRPSSGNLLQS
PEPSYGPARPRQQSLSKEGSIGGSGGSGGGGGGGLKPSITKQHSQTPSTLNPTMPASERT
VAWVSNMPHLSADIESAHIEREEYKLKEYSKSMDESRLDREYEEEIHSLKERLHMSNRKL
EEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRD
HPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAP

Transcript-based displays