Description

leucine-rich repeat kinase 2 [Source:HGNC Symbol;Acc:HGNC:18618]

Synonyms

DKFZp434H2111, FLJ45829, PARK8, RIPK7, ROCO2

Location
About this transcript

This transcript has 15 exons, is annotated with 2 domains and features, is associated with 357 variations and maps to 17 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
LRRK2-004ENST0000029891091582527aaENSP00000298910
 
Protein coding
CCDS31774Q5S007 NM_198578
NP_940980
TSL:1GENCODE basicAPPRIS P1
LRRK2-002ENST0000034374247401271aaENSP00000341930
 
Protein coding
-E9PC85 -TSL:5GENCODE basic
LRRK2-001ENST000004167961655521aaENSP00000398726
 
Protein coding
-C9JBF0 -CDS 3' incompleteTSL:3
LRRK2-005ENST000004308046400207aaENSP00000410821
 
Nonsense mediated decay
-H7C3B6 -CDS 5' incompleteTSL:1
LRRK2-007ENST00000481256561No protein-
 
Processed transcript
---TSL:4
LRRK2-003ENST000004791878306No protein-
 
Retained intron
---TSL:5
LRRK2-006ENST00000474202556No protein-
 
Retained intron
---TSL:4
Stable ID

ENSP00000398726.1

Status

Current

Latest Version

ENSP00000398726.1

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000188906ENST00000416796ENSP00000398726
MRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNL
SVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERG
NNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVV
KAVQQYPENAALQISALSCLALLRSFPGICECIVNSLRTKCNTSLDIMAAVVPKILTVMK
RHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNR
FIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGY
LITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFD
LVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLG
ADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRK
76ENSG00000188906ENST00000416796ENSP00000398726
MRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNL
SVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERG
NNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVV
KAVQQYPENAALQISALSCLALLRSFPGICECIVNSLRTKCNTSLDIMAAVVPKILTVMK
RHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNR
FIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGY
LITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFD
LVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLG
ADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRK
78ENSG00000188906ENST00000416796ENSP00000398726
MRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNL
SVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERG
NNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVV
KAVQQYPENAALQISALSCLALLRSFPGICECIVNSLRTKCNTSLDIMAAVVPKILTVMK
RHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNR
FIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGY
LITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFD
LVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLG
ADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRK
80ENSG00000188906ENST00000416796ENSP00000398726
MRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNL
SVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERG
NNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVV
KAVQQYPENAALQISALSCLALLRSFPGICECIVNSLRTKCNTSLDIMAAVVPKILTVMK
RHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNR
FIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGY
LITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFD
LVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLG
ADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRK

Transcript-based displays