Description

microtubule-associated protein tau [Source:HGNC Symbol;Acc:HGNC:6893]

Synonyms

DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau

Location
About this transcript

This transcript has 12 exons, is annotated with 22 domains and features, is associated with 295 variations and maps to 56 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
MAPT-203ENST000003442906816776aaENSP00000340820
 
Protein coding
CCDS45715P10636 NM_001123066
TSL:1GENCODE basicAPPRIS P4
MAPT-201ENST000002624106762758aaENSP00000262410
 
Protein coding
CCDS11501A0A024R9Y1 P10636 NM_016835
TSL:1GENCODE basicAPPRIS ALT2
MAPT-204ENST000003515595811441aaENSP00000303214
 
Protein coding
CCDS11499A0A024RA17 P10636 NM_005910
NP_005901
TSL:1GENCODE basicAPPRIS ALT2
MAPT-202ENST000003407995724412aaENSP00000340438
 
Protein coding
CCDS45716P10636 NM_001123067
NP_001116539
TSL:1GENCODE basicAPPRIS ALT2
MAPT-205ENST000005357725718410aaENSP00000443028
 
Protein coding
CCDS56033P10636 NM_001203251
NM_001203252
NP_001190180
NP_001190181
TSL:5GENCODE basic
MAPT-002ENST000004463615345383aaENSP00000408975
 
Protein coding
CCDS11500A0A024R9Y0 P10636 NM_016834
NP_058518
TSL:1GENCODE basicAPPRIS ALT2
MAPT-004ENST000004156132331776aaENSP00000410838
 
Protein coding
CCDS45715P10636 -TSL:5GENCODE basicAPPRIS P4
MAPT-008ENST000005719872277758aaENSP00000458742
 
Protein coding
CCDS11501A0A024R9Y1 P10636 -TSL:5GENCODE basicAPPRIS ALT2
MAPT-007ENST000005744361326441aaENSP00000460965
 
Protein coding
CCDS11499A0A024RA17 P10636 -TSL:5GENCODE basicAPPRIS ALT2
MAPT-003ENST000004206821239412aaENSP00000413056
 
Protein coding
CCDS45716P10636 -TSL:1GENCODE basicAPPRIS ALT2
MAPT-006ENST000004310081233410aaENSP00000389250
 
Protein coding
CCDS56033P10636 -TSL:5GENCODE basic
MAPT-001ENST000003342391107352aaENSP00000334886
 
Protein coding
CCDS11502P10636 NM_016841
NP_058525
TSL:1GENCODE basic
MAPT-009ENST000005765186778341aaENSP00000458621
 
Protein coding
-I3L170 -TSL:2GENCODE basic
MAPT-011ENST0000057131154459aaENSP00000460048
 
Nonsense mediated decay
-I3L2Z2 -TSL:4
MAPT-013ENST00000570299889No protein-
 
Processed transcript
---TSL:3
MAPT-012ENST00000577017142No protein-
 
Processed transcript
---TSL:3
MAPT-014ENST000005724405015No protein-
 
Retained intron
---TSL:NA
MAPT-010ENST000005762381065No protein-
 
Retained intron
---TSL:NA
Stable ID

ENSP00000303214.7

Status

Current

Latest Version

ENSP00000303214.7

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000186868ENST00000351559ENSP00000303214
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPK
TPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK
SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV
PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI
THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV
DSPQLATLADEVSASLAKQGL
76ENSG00000186868ENST00000351559ENSP00000303214
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPK
TPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK
SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV
PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI
THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV
DSPQLATLADEVSASLAKQGL
78ENSG00000186868ENST00000351559ENSP00000303214
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPK
TPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK
SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV
PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI
THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV
DSPQLATLADEVSASLAKQGL
80ENSG00000186868ENST00000351559ENSP00000303214
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPK
TPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK
SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV
PGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI
THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV
DSPQLATLADEVSASLAKQGL

Transcript-based displays