Description

microtubule-associated protein tau [Source:HGNC Symbol;Acc:HGNC:6893]

Synonyms

DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau

Location
Gene

This transcript is a product of gene ENSG00000186868

This gene has 18 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLengthProteinBiotypeCCDSUniProtRefSeqFlags
MAPT-203ENST000003442906816 bp776 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS45715P10636 NM_001123066
NP_001116538
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-201ENST000002624106762 bp758 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS11501P10636 NM_016835
NP_058519
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-204ENST000003515595811 bp441 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS11499P10636 NM_005910
NP_005901
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-202ENST000003407995724 bp412 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS45716P10636 NM_001123067
NP_001116539
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-205ENST000005357725718 bp410 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS56033B4DSE3 P10636 NM_001203251
NM_001203252
NP_001190180
NP_001190181
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-002ENST000004463615345 bp383 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS11500P10636 NM_016834
NP_058518
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-004ENST000004156132331 bp776 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS45715P10636 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-008ENST000005719872277 bp758 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS11501P10636 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-007ENST000005744361326 bp441 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS11499P10636 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-003ENST000004206821239 bp412 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS45716P10636 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-006ENST000004310081233 bp410 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS56033B4DSE3 P10636 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-001ENST000003342391107 bp352 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS11502B4DSE3 P10636 NM_016841
NP_058525
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-009ENST000005765186778 bp341 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-B4DSE3 I3L170 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
MAPT-011ENST00000571311544 bp59 aa (view)
 
Nonsense mediated decayTranscript is thought to undergo nonsense mediated decay, a process which detects nonsense mutations and prevents the expression of truncated or erroneous proteins.
-I3L2Z2 -
MAPT-013ENST00000570299889 bp No protein product
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---
MAPT-012ENST00000577017142 bp No protein product
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---
MAPT-014ENST000005724405015 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
MAPT-010ENST000005762381065 bp No protein product
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---
Stable ID

ENSP00000334886.8

Status

Current

Latest Version

ENSP00000334886.8

Release: 76 (current)

Assembly: GRCh38

Database: homo_sapiens_core_76_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000186868ENST00000334239ENSP00000334886
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEA
AGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPA
PKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSS
AKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIH
HKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG
AEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Transcript-based displays