Description

short stature homeobox [Source:HGNC Symbol;Acc:HGNC:10853]

Synonyms

SHOXY, GCFX, SS, PHOG

Location
About this transcript

This transcript has 5 exons, is annotated with 15 domains and features, is associated with 354 variations and maps to 29 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
SHOX-202ENST000003815783757292aaENSP00000370990
 
Protein coding
CCDS14107A0A024R385 O15266 NM_000451
NP_000442
TSL:5GENCODE basicAPPRIS P1
SHOX-201ENST000003340601951225aaENSP00000335505
 
Protein coding
CCDS14106O15266 NM_006883
NP_006874
TSL:5GENCODE basic
SHOX-003ENST000005549711902292aaENSP00000452016
 
Protein coding
CCDS14107A0A024R385 O15266 -TSL:1GENCODE basicAPPRIS P1
SHOX-001ENST000003815751351225aaENSP00000370987
 
Protein coding
CCDS14106O15266 -TSL:1GENCODE basic
Stable ID

ENSP00000452016.1

Status

Current

Latest Version

ENSP00000452016.1

Release: 83 (current)

Assembly: GRCh38

Database: homo_sapiens_core_83_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000185960ENST00000554971ENSP00000452016
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL
76ENSG00000185960ENST00000554971ENSP00000452016
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL
78ENSG00000185960ENST00000554971ENSP00000452016
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL
80ENSG00000185960ENST00000554971ENSP00000452016
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL
82ENSG00000185960ENST00000554971ENSP00000452016
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLM
FPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL

Transcript-based displays