Description

short stature homeobox [Source:HGNC Symbol;Acc:HGNC:10853]

Synonyms

GCFX, PHOG, SHOXY, SS

Location
About this transcript

This transcript has 6 exons, is annotated with 11 domains and features, is associated with 206 variations and maps to 32 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
SHOX-202ENST000003815783757292aaENSP00000370990
 
Protein coding
CCDS14107A0A024R385 O15266 NM_000451
NP_000442
TSL:5GENCODE basicAPPRIS P1
SHOX-201ENST000003340601951225aaENSP00000335505
 
Protein coding
CCDS14106O15266 NM_006883
NP_006874
TSL:5GENCODE basic
SHOX-003ENST000005549711902292aaENSP00000452016
 
Protein coding
CCDS14107A0A024R385 O15266 -TSL:1GENCODE basicAPPRIS P1
SHOX-001ENST000003815751351225aaENSP00000370987
 
Protein coding
CCDS14106O15266 -TSL:1GENCODE basic
Stable ID

ENSP00000335505.3

Status

Current

Latest Version

ENSP00000335505.3

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000185960ENST00000334060ENSP00000335505
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQMEFCSCRPGWSIMA
76ENSG00000185960ENST00000334060ENSP00000335505
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQMEFCSCRPGWSIMA
78ENSG00000185960ENST00000334060ENSP00000335505
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQMEFCSCRPGWSIMA
80ENSG00000185960ENST00000334060ENSP00000335505
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDIT
EGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRS
RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH
KGVILGTANHLDACRVAPYVNMGALRMPFQQMEFCSCRPGWSIMA

Transcript-based displays