Description

major histocompatibility complex, class II, DQ beta 1 [Source:HGNC Symbol;Acc:HGNC:4944]

Synonyms

CELIAC1, HLA-DQB, IDDM1

Location
Gene

This transcript is a product of gene ENSG00000179344
View alternative alleles of this gene

This gene has 9 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDbpProteinBiotypeCCDSUniProtRefSeqFlags
HLA-DQB1-003ENST000003990841734261 aa
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS43451F8LFZ1 F8LFZ3 I4EPK4
I4EPK9 L0BW29 L0BX86
L0BX94 M4YQH8 N0A0M1
N0A4C3 O19741 O78224
Q4VC55 Q5BLN2 Q5BLN3
Q5Y7D6 Q67AI9 Q67AJ0
Q8MHQ2 Q8SNB9 Q9BCT8
R4QU49 S6CPW2 S6CPW3
T1R348 U6EG31
-TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).APPRIS PIAPPRIS principal isoform [01-09-2014]
Glossary entry for APPRIS
APPRIS website
HLA-DQB1-002ENST000003749431656269 aa
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS59006F8LFZ1 F8LFZ3 I4EPK4
I4EPK9 L0BW29 L0BX86
L0BX94 M4YQH8 N0A0M1
N0A4C3 O19741 O78224
Q4VC55 Q5BLN2 Q5BLN3
Q5SU54 Q67AI9 Q67AJ0
Q8MHQ2 Q8SNB9 Q9BCT8
R4QU49 S6CPW2 S6CPW3
T1R348 U6EG31
NM_001243961
NP_001230890
TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
HLA-DQB1-001ENST000004346511642261 aa
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS43451F8LFZ1 F8LFZ3 I4EPK4
I4EPK9 L0BW29 L0BX86
L0BX94 M4YQH8 N0A0M1
N0A4C3 O19741 O78224
Q4VC55 Q5BLN2 Q5BLN3
Q5Y7D6 Q67AI9 Q67AJ0
Q8MHQ2 Q8SNB9 Q9BCT8
R4QU49 S6CPW2 S6CPW3
T1R348 U6EG31
NM_002123
NP_002114
TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).APPRIS PIAPPRIS principal isoform [01-09-2014]
Glossary entry for APPRIS
APPRIS website
HLA-DQB1-004ENST000003990791501224 aa
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-A2AAZ0 F8LFZ1 F8LFZ3
I4EPK4 I4EPK9 L0BW29
L0BX86 L0BX94 M4YQH8
N0A0M1 N0A4C3 O19741
O78224 Q4VC55 Q5BLN2
Q5BLN3 Q8MHQ2 Q8SNB9
Q9BCT8 R4QU49 S6CPW2
S6CPW3 T1R348 U6EG31
-TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
HLA-DQB1-007ENST000003990821219134 aa
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-A2AAY8 Q4VC55 Q5BLN2
Q5BLN3 Q8MHQ2 Q8SNB9
Q9BCT8
-TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
HLA-DQB1-008ENST00000484729783136 aa
 
Nonsense mediated decayTranscript is thought to undergo nonsense mediated decay, a process which detects nonsense mutations and prevents the expression of truncated or erroneous proteins.
-E9PIB1 L0BW29 L0BX86
L0BX94 M4YQH8 N0A0M1
N0A4C3 O19741 O78224
Q4VC55 Q5BLN2 Q5BLN3
Q8MHQ2 Q8SNB9 Q9BCT8
R4QU49 T1R348
-TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

HLA-DQB1-009ENST00000460185428No protein
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

HLA-DQB1-010ENST00000443574309No protein
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---TSL:5

TSL5: No single transcript (mRNA or EST) supports this transcript model's structure.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

HLA-DQB1-005ENST000004876764644No protein
 
Retained intronAlternatively spliced transcript that is believed to contain intronic sequence relative to other coding transcripts in a given locus.
---TSL:NA

TSL:NA:The transcript was not analyzed for one of the following reasons:

  • Pseudogene annotation, including transcribed pseudogenes
  • Human leukocyte antigen (HLA) transcript
  • Immunoglobin gene transcript
  • T-cell receptor transcript
  • Single-exon transcript (will be included in a future version)

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

Stable ID

ENSP00000382032.3

Status

Current

Latest Version

ENSP00000382032.3

Release: 77 (current)

Assembly: GRCh38

Database: homo_sapiens_core_77_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000179344ENST00000399082ENSP00000382032
MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPVEPTVTISPSRTEALNHHNLLVCS
VTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHP
SLQSPITVEWRLLH
76ENSG00000179344ENST00000399082ENSP00000382032
MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPVEPTVTISPSRTEALNHHNLLVCS
VTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHP
SLQSPITVEWRLLH

Transcript-based displays