Description

orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522]

Synonyms

Location
Gene

This transcript is a product of gene ENSG00000165588

This gene has 7 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLengthProteinBiotypeCCDSUniProtRefSeqFlags
OTX2-001ENST000003394752199 bp297 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS9728F1T0D1 G3V3P9 P32243
NM_001270525
NM_021728
NP_001257454
NP_068374
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
OTX2-002ENST000005550061279 bp289 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS41960F1T0D0 G3V3J3 P32243
NM_001270523
NM_001270524
NP_001257452
NP_001257453
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
OTX2-007ENST000004089901082 bp289 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS41960F1T0D0 G3V3J3 P32243
NM_172337
NP_758840
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
OTX2-006ENST00000554845908 bp239 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-G3V3P9 -CDS 3' incomplete3' truncation in transcript evidence prevents annotation of the end of the CDS.
OTX2-005ENST00000554788835 bp35 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-F1T0C9 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
OTX2-003ENST00000555804797 bp163 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-G3V3J3 -CDS 3' incomplete3' truncation in transcript evidence prevents annotation of the end of the CDS.
OTX2-004ENST00000554559715 bp35 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-F1T0C9 -GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
Stable ID

ENSP00000474486.1

Status

Current

Latest Version

ENSP00000474486.1

Release: 76 (current)

Assembly: GRCh38

Database: homo_sapiens_core_76_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000165588ENST00000554788ENSP00000474486
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGMV

Transcript-based displays