Description

orthodenticle homeobox 2 [Source:HGNC Symbol;Acc:HGNC:8522]

Location
About this transcript

This transcript has 2 exons, is associated with 9 variations and maps to 4 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
OTX2-001ENST000003394753001297aaENSP00000343819
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS9728F1T0D1 P32243 NM_001270525
NM_021728
NP_001257454
NP_068374
TSL:1

TSL1: All splice junctions of the transcript are supported by at least one non-suspect mRNA.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
OTX2-002ENST000005550061279289aaENSP00000452336
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS41960P32243 NM_001270523
NM_001270524
NP_001257452
NP_001257453
TSL:1

TSL1: All splice junctions of the transcript are supported by at least one non-suspect mRNA.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).APPRIS PI1APPRIS principal isoform
Glossary entry for APPRIS
APPRIS website
OTX2-007ENST000004089901082289aaENSP00000386185
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS41960P32243 NM_172337
NP_758840
TSL:1

TSL1: All splice junctions of the transcript are supported by at least one non-suspect mRNA.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).APPRIS PI1APPRIS principal isoform
Glossary entry for APPRIS
APPRIS website
OTX2-006ENST00000554845908239aaENSP00000451357
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-G3V3P9 -CDS 3' incomplete3' truncation in transcript evidence prevents annotation of the end of the CDS.TSL:1

TSL1: All splice junctions of the transcript are supported by at least one non-suspect mRNA.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

OTX2-005ENST0000055478883535aaENSP00000474486
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-F1T0C9 -TSL:1

TSL1: All splice junctions of the transcript are supported by at least one non-suspect mRNA.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
OTX2-003ENST00000555804797163aaENSP00000451272
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-G3V3J3 -CDS 3' incomplete3' truncation in transcript evidence prevents annotation of the end of the CDS.TSL:4

TSL4:The best supporting EST for this transcript is flagged as suspect.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

OTX2-004ENST0000055455971535aaENSP00000450468
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
-F1T0C9 -TSL:5

TSL5: No single transcript (mRNA or EST) supports this transcript model's structure.

The Transcript Support Level (TSL) is a method to highlight the well-supported and poorly-supported transcript models for users. The method relies on the primary data that can support full-length transcript structure: mRNA and EST alignments supplied by UCSC and Ensembl.

GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
Stable ID

ENSP00000474486.1

Status

Current

Latest Version

ENSP00000474486.1

Release: 79 (current)

Assembly: GRCh38

Database: homo_sapiens_core_79_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000165588ENST00000554788ENSP00000474486
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGMV
76ENSG00000165588ENST00000554788ENSP00000474486
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGMV
78ENSG00000165588ENST00000554788ENSP00000474486
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGMV

Transcript-based displays