Description

fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240]

Synonyms

FRCP2

Location
Gene

This transcript is a product of gene ENSG00000160097

This gene has 6 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLengthProteinBiotypeCCDSUniProtRefSeqFlags
FNDC5-001ENST000003734712732 bp212 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS369-NM_001171940
NM_153756
NP_001165411
NP_715637
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
FNDC5-006ENST00000496770837 bp153 aa (view)
 
Protein codingGenes and/or transcript that contains an open reading frame (ORF).
CCDS65483Q8NAU1 NM_001171941
NP_001165412
GENCODE basicThe GENCODE set is the gene set for human and mouse. GENCODE Basic is a subset of representative transcripts (splice variants).
FNDC5-003ENST000004814871563 bp No protein product
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---
FNDC5-005ENST00000497068407 bp No protein product
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---
FNDC5-004ENST00000483143308 bp No protein product
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---
FNDC5-007ENST00000465346192 bp No protein product
 
Processed transcriptTranscripts that don't contain an open reading frame (ORF) and cannot be placed in one of the other categories.
---
Stable ID

ENSP00000362570.4

Status

Current

Latest Version

ENSP00000362570.4

Release: 76 (current)

Assembly: GRCh38

Database: homo_sapiens_core_76_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000160097ENST00000373471ENSP00000362570
IHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI

Transcript-based displays