Description

fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240]

Synonyms

FRCP2

Location
About this transcript

This transcript has 6 exons, is annotated with 10 domains and features, is associated with 51 variations and maps to 32 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
FNDC5-001ENST000003734712732212aaENSP00000362570
 
Protein coding
CCDS369A0A0A0MRR6 NM_001171940
NM_153756
NP_001165411
NP_715637
TSL:2GENCODE basic
FNDC5-006ENST00000496770837153aaENSP00000476320
 
Protein coding
CCDS65483Q8NAU1 NM_001171941
NP_001165412
TSL:1GENCODE basicAPPRIS P1
FNDC5-003ENST000004814871563No protein-
 
Processed transcript
---TSL:1
FNDC5-005ENST00000497068407No protein-
 
Processed transcript
---TSL:2
FNDC5-004ENST00000483143308No protein-
 
Processed transcript
---TSL:3
FNDC5-007ENST00000465346192No protein-
 
Processed transcript
---TSL:5
Stable ID

ENSP00000362570.4

Status

Current

Latest Version

ENSP00000362570.4

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000160097ENST00000373471ENSP00000362570
IHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
76ENSG00000160097ENST00000373471ENSP00000362570
IHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
78ENSG00000160097ENST00000373471ENSP00000362570
IHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
80ENSG00000160097ENST00000373471ENSP00000362570
IHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDE
VVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPV
LFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIK
DNEPNNNKEKTKSASETSTPEHQGGGLLRSKI

Transcript-based displays