Description

parkinson protein 7 [Source:HGNC Symbol;Acc:HGNC:16369]

Synonyms

DJ-1, DJ1

Location
About this transcript

This transcript has 7 exons, is annotated with 6 domains and features, is associated with 89 variations and maps to 46 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
PARK7-001ENST000004936781088189aaENSP00000418770
 
Protein coding
CCDS93Q99497 V9HWC2 -TSL:1GENCODE basicAPPRIS P1
PARK7-005ENST00000377491977189aaENSP00000366711
 
Protein coding
CCDS93Q99497 V9HWC2 -TSL:3GENCODE basicAPPRIS P1
PARK7-002ENST00000338639949189aaENSP00000340278
 
Protein coding
CCDS93Q99497 V9HWC2 NM_001123377
NM_007262
NP_001116849
NP_009193
TSL:1GENCODE basicAPPRIS P1
PARK7-006ENST00000377488783189aaENSP00000366708
 
Protein coding
CCDS93Q99497 V9HWC2 -TSL:3GENCODE basicAPPRIS P1
PARK7-003ENST00000377493795169aaENSP00000466242
 
Protein coding
-K7ELW0 -TSL:2GENCODE basic
PARK7-010ENST00000469225711160aaENSP00000466756
 
Protein coding
-K7EN27 -CDS 5' incompleteTSL:3
PARK7-004ENST00000493373624189aaENSP00000465404
 
Protein coding
-Q99497 V9HWC2 -CDS 3' incompleteTSL:5
PARK7-009ENST00000497113670No protein-
 
Processed transcript
---TSL:3
PARK7-008ENST00000465354949No protein-
 
Retained intron
---TSL:2
PARK7-007ENST00000460192567No protein-
 
Retained intron
---TSL:3
Stable ID

ENSP00000366711.1

Status

Current

Latest Version

ENSP00000366711.1

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000116288ENST00000377491ENSP00000366711
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD
76ENSG00000116288ENST00000377491ENSP00000366711
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD
78ENSG00000116288ENST00000377491ENSP00000366711
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD
80ENSG00000116288ENST00000377491ENSP00000366711
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD

Transcript-based displays