Description

protein kinase, cAMP-dependent, catalytic, alpha [Source:HGNC Symbol;Acc:HGNC:9380]

Synonyms

PKACa

Location
About this transcript

This transcript has 10 exons, is annotated with 12 domains and features, is associated with 155 variations and maps to 42 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
PRKACA-001ENST000003086772677351aaENSP00000309591
 
Protein coding
CCDS12304A0A024R7J0 P17612 NM_002730
NP_002721
TSL:1GENCODE basicAPPRIS P1
PRKACA-003ENST000005899941127343aaENSP00000466651
 
Protein coding
CCDS12305P17612 NM_207518
NP_997401
TSL:2GENCODE basic
PRKACA-002ENST000005908531101124aaENSP00000466976
 
Protein coding
-K7ENJ5 -TSL:5GENCODE basic
PRKACA-006ENST00000593092922207aaENSP00000466289
 
Protein coding
-Q15136 -CDS 5' incompleteTSL:1
PRKACA-010ENST00000587372824251aaENSP00000468352
 
Protein coding
-K7ERP6 -CDS 5' incompleteTSL:3
PRKACA-008ENST0000058928440325aaENSP00000466660
 
Protein coding
-K7EMV1 -CDS 3' incompleteTSL:5
PRKACA-005ENST000003503563105No protein-
 
Processed transcript
---TSL:2
PRKACA-007ENST000005875332095No protein-
 
Retained intron
---TSL:NA
PRKACA-004ENST000005366491524No protein-
 
Retained intron
---TSL:2
PRKACA-009ENST00000588209942No protein-
 
Retained intron
---TSL:3
Stable ID

ENSP00000309591.3

Status

Current

Latest Version

ENSP00000309591.3

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000072062ENST00000308677ENSP00000309591
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
76ENSG00000072062ENST00000308677ENSP00000309591
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
78ENSG00000072062ENST00000308677ENSP00000309591
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
80ENSG00000072062ENST00000308677ENSP00000309591
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Transcript-based displays