Description

RAD51 recombinase [Source:HGNC Symbol;Acc:HGNC:9817]

Synonyms

BRCC5, HsRad51, HsT16930, RAD51A, RECA

Location
About this transcript

This transcript has 6 exons, is annotated with 9 domains and features, is associated with 35 variations and maps to 10 oligo probes.

Gene
NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
RAD51-001ENST000002678682449339aaENSP00000267868
 
Protein coding
CCDS10062Q06609 NM_002875
NP_002866
TSL:1GENCODE basicAPPRIS P1
RAD51-002ENST000004231691611280aaENSP00000406602
 
Protein coding
CCDS53932Q06609 NM_001164270
NP_001157742
TSL:1GENCODE basic
RAD51-009ENST000003826431588340aaENSP00000372088
 
Protein coding
CCDS53931Q06609 NM_001164269
NP_001157741
TSL:2GENCODE basic
RAD51-008ENST000005327431515340aaENSP00000433924
 
Protein coding
CCDS53931Q06609 NM_133487
NP_597994
TSL:2GENCODE basic
RAD51-003ENST000005578501397242aaENSP00000454176
 
Protein coding
-Q06609 -TSL:2GENCODE basic
RAD51-006ENST0000052676362575aaENSP00000431897
 
Protein coding
-Q9NZG9 -CDS 3' incompleteTSL:3
RAD51-007ENST00000527860566172aaENSP00000432759
 
Protein coding
-E9PNT5 -CDS 3' incompleteTSL:4
RAD51-004ENST000005250661545151aaENSP00000431864
 
Nonsense mediated decay
-E9PJ30 -TSL:5
RAD51-010ENST00000531277658100aaENSP00000436512
 
Nonsense mediated decay
-E9PI54 -TSL:3
RAD51-013ENST0000053374142565aaENSP00000433053
 
Nonsense mediated decay
-H0YD61 -CDS 5' incompleteTSL:1
Stable ID

ENSP00000432759.1

Status

Current

Latest Version

ENSP00000432759.1

Release: 81 (current)

Assembly: GRCh38

Database: homo_sapiens_core_81_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
75ENSG00000051180ENST00000527860ENSP00000432759
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLL
76ENSG00000051180ENST00000527860ENSP00000432759
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLL
78ENSG00000051180ENST00000527860ENSP00000432759
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLL
80ENSG00000051180ENST00000527860ENSP00000432759
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLL

Transcript-based displays