Description

partner and localizer of BRCA2 [Source:HGNC Symbol;Acc:HGNC:26144]

Synonyms

FLJ21816, FANCN, PNCA3

Location

Chromosome 16: 23,603,160-23,641,310 reverse strand.

GRCh38:CM000678.2

About this gene

This gene has 6 transcripts (splice variants), 62 orthologues, is a member of 4 Ensembl protein families and is associated with 25 phenotypes.

NameTranscript IDbpProteinTranslation IDBiotypeCCDSUniProtRefSeqFlags
PALB2-001ENST0000026158440031186aaENSP00000261584
 
Protein coding
CCDS32406Q86YC2 NM_024675
NP_078951
TSL:1GENCODE basicAPPRIS P2
PALB2-002ENST000005682193963891aaENSP00000454703
 
Protein coding
-H3BN63 -TSL:1GENCODE basicAPPRIS ALT2
PALB2-006ENST0000056151481590aaENSP00000460666
 
Protein coding
-I3L3R6 -CDS 3' incompleteTSL:5
PALB2-005ENST0000056606962643aaENSP00000459237
 
Protein coding
-I3L1Z5 -CDS 5' incompleteTSL:5
PALB2-004ENST0000056503834430aaENSP00000459882
 
Nonsense mediated decay
-I3L2S5 -CDS 5' incompleteTSL:3
PALB2-003ENST00000567003789No protein-
 
Processed transcript
---TSL:3
Stable ID

ENSG00000083093.9

Status

Current

Latest Version

ENSG00000083093.9

Release: 83 (current)

Assembly: GRCh38

Database: homo_sapiens_core_83_38

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
82ENSG00000083093ENST00000568219ENSP00000454703
MDEPPGKPLSFKGEISILEKGIQQDTSPPSACPKS

Gene-based displays