Description

partner and localizer of BRCA2 [Source:HGNC Symbol;Acc:26144]

Location
INSDC coordinates

chromosome:GRCh37:CM000678.1:23614488:23652631:1

Transcripts

This gene has 6 transcripts (splice variants) Show transcript tableHide transcript table

NameTranscript IDLength (bp)Protein IDLength (aa)BiotypeCDS incompleteCCDSGENCODE basic
PALB2-001ENST000002615844003ENSP000002615841186Protein codingGenes and/or transcript that contains an open reading frame (ORF).-CCDS32406YThe GENCODE Basic set includes all genes in the GENCODE gene set but only a subset of the transcripts.
PALB2-006ENST00000561514815ENSP0000046066690Protein codingGenes and/or transcript that contains an open reading frame (ORF).3'--
PALB2-005ENST00000566069619ENSP0000045923743Protein codingGenes and/or transcript that contains an open reading frame (ORF).5'--
PALB2-002ENST000005682193963ENSP0000045470335Nonsense mediated decayTranscript is thought to undergo nonsense mediated decay, a process which detects nonsense mutations and prevents the expression of truncated or erroneous proteins. ---
PALB2-003ENST00000567003789ENSP0000045552427Nonsense mediated decayTranscript is thought to undergo nonsense mediated decay, a process which detects nonsense mutations and prevents the expression of truncated or erroneous proteins. ---
PALB2-004ENST00000565038344ENSP0000045988230Nonsense mediated decayTranscript is thought to undergo nonsense mediated decay, a process which detects nonsense mutations and prevents the expression of truncated or erroneous proteins. 5'--
Stable ID

ENSG00000083093.5

Status

Current

Latest Version

ENSG00000083093.5

Release: 75 (current)

Assembly: GRCh37

Database: homo_sapiens_core_75_37

Associated archived IDs for this stable ID version

ReleaseGeneTranscriptProtein
66ENSG00000083093ENST00000568219ENSP00000454703
MTVSTDNLLVNKAISKSGQLPTSSNLEANISCSLNELTYNNLPANENQNLKEQNQTEKSL
KSPSDTLDGRNENLQESEILSQPKSLSLEATSPLSAEKHSCTVPEGLLFPAEYYVRTTRS
MSNCQRKVAVEAVIQSHLDVKKKGFKNKNKDASKNLNLSNEETDQSEIRMSGTCTGQPSS
RTSQKLLSLTKVSSPAGPTEDNDLSRKAVAQAPGRRYTGKRKSACTPASDHCEPLLPTSS
LSIVNRSKEEVTSHKYQHEKLFIQVKGKKSRHQKEDSLSWSNSAYLSLDDDAFTAPFHRD
GMLSLKQLLSFLSITDFQLPDEDFGPLKLEKVKSCSEKPVEPFESKMFGERHLKEGSCIF
PEELSPKRMDTEMEDLEEDLIVLPGKSHPKRPNSQSQHTKTGLSSSILLYTPLNTVAPDD
NDRPTTDMCSPAFPILGTTPAFGPQGSYEKASTEVAGRTCCTPQLAHLKDSVCLASDTKQ
FDSSGSPAKPHTTLQVSGRQGQPTCDCDSVPPGTPPPIESFTFKENQLCRNTCQELHKHS
VEQTETAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITACEDVV
SLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDES
EKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILT
FAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLS
HPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSG
TIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS

Gene-based displays